Zscan12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Zscan12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	zinc finger and SCAN domain containing 12
Database Link	NP_057893 Entrez Gene 22758 Mouse UniProt ID Q9Z1D7
Background	May be involved in transcriptional regulation.
Synonyms	dJ29K1.2; KIAA0426; OTTHUMP00000016205; ZFP96; ZNF29K1; ZNF96; ZNF305
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.