Atoh7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Atoh7 antibody: synthetic peptide directed towards the C terminal of mouse Atoh7. Synthetic peptide located within the following region: IALTRILAEAERDWVGLRCEQRGRDHPYLPFPGARLQVDPEPYGQRLFGF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	atonal bHLH transcription factor 7
Database Link	NP_058560 Entrez Gene 53404 Mouse UniProt ID Q9Z2E5
Background	Atoh7 is a transcription factor involved in the differentiation of most retinal ganglion cells, including those constituting the retino-hypothalamic tract.
Synonyms	bHLHa13; Math5
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.