Achaete scute homolog 3 (ASCL3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3. Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	achaete-scute family bHLH transcription factor 3
Database Link	NP_065697 Entrez Gene 56787 Mouse UniProt ID Q9NQ33
Background	Transcriptional repressor. Inhibits myogenesis.
Synonyms	bHLHa42; HASH3; SGN1
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Bovine: 92%; Dog: 85%; Pig: 85%; Human: 85%; Guinea pig: 85%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.