TMEM33 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tmem33 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	transmembrane protein 33
Database Link	NP_060596 Entrez Gene 59303 Rat UniProt ID P57088
Background	putative integral membrane protein [RGD, Feb 2006]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer protein (isoform 1). Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: AB006135.1, CK359233.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
Synonyms	1600019D15Rik; SHINC-3; SHINC3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.