CSGALNACT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CSGALNACT1 antibody: synthetic peptide directed towards the N terminal of human CSGALNACT1. Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	chondroitin sulfate N-acetylgalactosaminyltransferase 1
Database Link	NP_060841 Entrez Gene 55790 Human UniProt ID Q8TDX6
Background	CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
Synonyms	beta4GalNAcT; ChGn; CSGalNAcT-1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Chondroitin sulfate biosynthesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.