ZNF37A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the middle region of human ZNF37A. Synthetic peptide located within the following region: QQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYECHECGKTFYK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	zinc finger protein 37A
Database Link	NP_001007095 Entrez Gene 7587 Human UniProt ID P17032
Background	May be involved in transcriptional regulation.
Synonyms	KOX21; ZNF37
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.