C3ORF31 (TAMM41) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAMM41 antibody is: synthetic peptide directed towards the C-terminal region of Human TAMM41. Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	TAM41 mitochondrial translocator assembly and maintenance homolog
Database Link	NP_620162 Entrez Gene 132001 Human UniProt ID Q96BW9
Background	May be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Synonyms	C3orf31; RAM41; TAM41
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.