USP8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	127 kDa
Gene Name	ubiquitin specific peptidase 8
Database Link	NP_005145 Entrez Gene 9101 Human UniProt ID P40818
Background	USP8 is a hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. USP8 catalytic activity is enhanced in the M phase. USP8 is involved in cell proliferation. USP8 is required to enter into S phase in response to serum stimulation. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. USP8 probably regulates the stability of STAM2 and RASGRF1. USP8 regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle.USP8 deubiquitinates EPS15 and controles tyrosine kinase stability.USP8 removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. USP8 is involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules.
Synonyms	HumORF8; SPG59; UBPY
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Protease
Protein Pathways	Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.