USP47 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-USP47 antibody: synthetic peptide directed towards the middle region of human USP47. Synthetic peptide located within the following region: SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	147 kDa
Gene Name	ubiquitin specific peptidase 47
Database Link	NP_060414 Entrez Gene 55031 Human UniProt ID Q96K76
Background	USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.
Synonyms	TRFP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.