ISG15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	ISG15 ubiquitin-like modifier
Database Link	NP_005092 Entrez Gene 100038882 MouseEntrez Gene 9636 Human UniProt ID P05161
Background	ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha.
Synonyms	G1P2; hUCRP; IFI15; IMD38; IP17; UCRP
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	RIG-I-like receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.