FBXL12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FBXL12 antibody: synthetic peptide directed towards the C terminal of human FBXL12. Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	F-box and leucine-rich repeat protein 12
Database Link	NP_060173 Entrez Gene 54850 Human UniProt ID Q9NXK8
Background	Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Synonyms	Fbl12
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.