Synaptotagmin V (SYT5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYT5 antibody: synthetic peptide directed towards the middle region of human SYT5. Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	synaptotagmin 5
Database Link	NP_003171 Entrez Gene 53420 MouseEntrez Gene 6861 Human UniProt ID O00445
Background	Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium. Synaptotagmins may act both as negative regulators of vesicle fusion, allowing fusion in the presence of calcium, and as calcium receptors or sensor molecules (summary by Hudson and Birnbaum, 1995 [PubMed 7597049]).
Synonyms	synaptotagmin 5; synaptotagmin V
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Guinea pig: 100%; Human: 93%; Bovine: 93%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.