TAC1 Rabbit Polyclonal Antibody
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 13 kDa |
Gene Name | tachykinin precursor 1 |
Database Link | |
Background | This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene. |
Synonyms | Hs.2563; NK2; NKNA; NPK; TAC2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 92%; Bovine: 92%; Mouse: 85%; Yeast: 79% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Saponin extract of Baihe - Zhimu Tang ameliorates depression in chronic mild stress rats
,Jia, D;Dou, Y;He, Y;Zhou, X;Gao, Y;Ma, M;Wu, Z;Li, W;,
Journal of Functional Foods
[TAC1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |