IGSF8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IGSF8 antibody: synthetic peptide directed towards the middle region of human IGSF8. Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	immunoglobulin superfamily member 8
Database Link	NP_443100 Entrez Gene 93185 Human UniProt ID Q969P0
Background	IGSF8 may play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. IGSF8 may regulate proliferation and differentiation of keratinocytes. IGSF8 may be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. IGSF8 may also play a role on integrin-dependent morphology and motility functions. IGSF8 may participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.
Synonyms	CD81P3; CD316; EWI-2; EWI2; KCT-4; LIR-D1; PGRL
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 83%; Dog: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.