FAM126A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM126A antibody: synthetic peptide directed towards the C terminal of human FAM126A. Synthetic peptide located within the following region: MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	family with sequence similarity 126 member A
Database Link	NP_115970 Entrez Gene 84668 Human UniProt ID Q9BYI3
Background	FAM126A may play a part in the beta-catenin/Lef signaling pathway. Expression of FAM126A gene is down-regulated by beta-catenin. Defects in FAM126A gene are a cause of hypomyelination with congenital cataract (HCC).
Synonyms	DRCTNNB1A; HCC; HLD5; HYCC1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%; Dog: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.