MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MAPKAPK2 antibody is: synthetic peptide directed towards the C-terminal region of Human MAPKAPK2. Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	mitogen-activated protein kinase-activated protein kinase 2
Database Link	NP_004750 Entrez Gene 17164 MouseEntrez Gene 9261 Human UniProt ID P49137
Background	MAPKAPK2 is a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo.
Synonyms	MAPKAP-K2; MK-2; MK2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 83%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.