SPRED2 Rabbit Polyclonal Antibody
CAT#: TA342931
Rabbit Polyclonal Anti-SPRED2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 3,080.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SPRED2 antibody: synthetic peptide directed towards the C terminal of human SPRED2. Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | sprouty related EVH1 domain containing 2 |
Database Link | |
Background | SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade . |
Synonyms | Spred-2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Dog: 92%; Zebrafish: 85% |
Reference Data | |
Protein Pathways | Jak-STAT signaling pathway |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Expression of Spred2 in the urothelial tumorigenesis of the urinary bladder
,null,
PLoS ONE
,PubMed ID 34818323
[SPRED2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |