FLYWCH1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FLYWCH1 antibody: synthetic peptide directed towards the C terminal of human FLYWCH1. Synthetic peptide located within the following region: ARMGCRSRAITQGRRVTVMRGHCHPPDLGGLEALRQREKRPNTAQRGSPG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	FLYWCH-type zinc finger 1
Database Link	NP_115672 Entrez Gene 84256 Human UniProt ID Q4VC44
Background	The function remains unknown.
Synonyms	FLYWCH-type zinc finger 1; KIAA1552
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.