VPS25 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	vacuolar protein sorting 25 homolog
Database Link	NP_115729 Entrez Gene 681059 Rat UniProt ID Q9BRG1
Background	Vps25 is a component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL.
Synonyms	DERP9; EAP20; FAP20
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.