ZCCHC7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZCCHC7 antibody: synthetic peptide directed towards the C terminal of human ZCCHC7. Synthetic peptide located within the following region: KNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHYH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	zinc finger CCHC-type containing 7
Database Link	NP_115602 Entrez Gene 84186 Human UniProt ID Q8N3Z6
Background	The function of this protein remains unknown.
Synonyms	AIR1; HSPC086
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 79%
Reference Data
Protein Pathways	RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.