AKAP associated Sperm Protein (ROPN1L) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ROPN1L antibody: synthetic peptide directed towards the C terminal of human ROPN1L. Synthetic peptide located within the following region: DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	rhophilin associated tail protein 1 like
Database Link	NP_114122 Entrez Gene 83853 Human UniProt ID Q96C74
Background	This gene encodes a member of the ropporin family. The encoded protein is a sperm protein. It interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them.
Synonyms	ASP; RSPH11
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.