RAB34 Rabbit Polyclonal Antibody
CAT#: TA342992
Rabbit Polyclonal Anti-RAB34 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB34 antibody: synthetic peptide directed towards the C terminal of human RAB34. Synthetic peptide located within the following region: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | RAB34, member RAS oncogene family |
Database Link | |
Background | RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways. |
Synonyms | RAB39; RAH |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |