PPP1R15B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PPP1R15B antibody: synthetic peptide directed towards the C terminal of human PPP1R15B. Synthetic peptide located within the following region: SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	protein phosphatase 1 regulatory subunit 15B
Database Link	NP_116222 Entrez Gene 84919 Human
Background	PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alpha through recruitment of protein phosphatase-1 (PP1) catalytic subunits.
Synonyms	CREP; MSSGM2
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 91%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.