MASTL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	97 kDa
Gene Name	microtubule associated serine/threonine kinase like
Database Link	NP_116233 Entrez Gene 84930 Human UniProt ID Q96GX5
Background	This gene encodes a microtubule-associated serine/threonine kinase. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus.
Synonyms	GREATWALL; GW; GWL; MAST-L; THC2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 82%; Pig: 79%; Horse: 79%; Bovine: 79%; Rat; Mouse; Guinea pig
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.