CAB39L Rabbit Polyclonal Antibody
CAT#: TA343048
Rabbit Polyclonal Anti-CAB39L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CAB39L antibody: synthetic peptide directed towards the N terminal of human CAB39L. Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | calcium binding protein 39 like |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | bA103J18.3; MO2L; MO25-BETA |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93% |
Reference Data | |
Protein Pathways | mTOR signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |