GPAT4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AGPAT6 antibody: synthetic peptide directed towards the middle region of human AGPAT6. Synthetic peptide located within the following region: MSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	glycerol-3-phosphate acyltransferase 4
Database Link	NP_848934 Entrez Gene 137964 Human UniProt ID Q86UL3
Background	Lysophosphatidic acid acyltransferases catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). LPA and PA are involved in signal transduction and lipid biosynthesis.
Synonyms	1-AGPAT 6; AGPAT6; LPAAT-zeta; LPAATZ; TSARG7
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Goat: 86%; Mouse: 86%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.