ASAH3 (ACER1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	alkaline ceramidase 1
Database Link	NP_597999 Entrez Gene 125981 Human UniProt ID Q8TDN7
Background	ACER1 hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid at an optimal pH of 8.0. It has a highly restricted substrate specificity for the natural stereoisomer of ceramide with D-erythro-sphingosine but not D-ribo-phytosphingosine or D-erythro-dihydrosphingosine as a backbone. It may have a role in regulating the levels of bioactive lipids ceramide and sphingosine 1-phosphate, as well as complex sphingolipids.
Synonyms	ALKCDase1; ASAH3
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.