CDA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	cytidine deaminase
Database Link	NP_001776 Entrez Gene 978 Human UniProt ID P32320
Background	This gene encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias.
Synonyms	CDD
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Zebrafish: 90%; Mouse: 86%; Bovine: 86%; Horse: 83%; Yeast: 83%
Reference Data
Protein Families	Stem cell - Pluripotency
Protein Pathways	Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.