IL17RD Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IL17RD antibody is: synthetic peptide directed towards the C-terminal region of Human IL17RD. Synthetic peptide located within the following region: STKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	interleukin 17 receptor D
Database Link	NP_060033 Entrez Gene 54756 Human UniProt ID Q8NFM7
Background	This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not require the interleukin (PMID: 19079364). The gene product also affects fibroblast growth factor signaling, inhibiting or stimulating growth through MAPK/ERK signaling.
Synonyms	HH18; IL-17RD; IL17RLM; SEF
Note	Immunogen Sequence Homology: Human: 100%; Rat: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.