COQ9 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-COQ9 antibody is: synthetic peptide directed towards the N-terminal region of COQ9. Synthetic peptide located within the following region: AFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | coenzyme Q9 |
Database Link | |
Background | This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency. |
Synonyms | C16orf49; COQ10D5 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 90%; Guinea pig: 90%; Rabbit: 86%; Rat: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |