IL13 receptor alpha 1 (IL13RA1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	interleukin 13 receptor subunit alpha 1
Database Link	NP_001551 Entrez Gene 16164 MouseEntrez Gene 3597 Human UniProt ID P78552
Background	The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
Synonyms	CD213A1; CT19; IL-13Ra; NR4
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rat: 86%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.