CD200 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	CD200 molecule
Database Link	NP_005935 Entrez Gene 4345 Human UniProt ID P41217
Background	The function of this protein remains unknown.
Synonyms	MOX1; MOX2; MRC; OX-2
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Pig: 92%; Rat: 92%; Horse: 85%; Guinea pig
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.