TBC1D4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TBC1D4 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D4. Synthetic peptide located within the following region: EMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLEKLER
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	146 kDa
Gene Name	TBC1 domain family member 4
Database Link	NP_055647 Entrez Gene 9882 Human UniProt ID O60343
Background	TBC1D4 may act as a GTPase-activating protein for RAB2A, RAB8A, RAB10 and RAB14. Isoform 2 promotes insulin-induced glucose transporter SLC2A4/GLUT4 translocation at the plasma membrane, thus increasing glucose uptake.
Synonyms	AS160; NIDDM5
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 83%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.