STRA8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Stra8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stra8. Synthetic peptide located within the following region: FLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFKSLGCVNTPLN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	stimulated by retinoic acid 8
Database Link	NP_872295 Entrez Gene 20899 Mouse UniProt ID Q7Z7C7
Background	Stra8 is a meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, It is required for premeiotic DNA replication and subsequent events in meiotic prophase.
Synonyms	stimulated by retinoic acid gene 8 homolog (mouse)
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 92%; Dog: 86%; Rat: 86%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.