TULP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TULP3 antibody: synthetic peptide directed towards the N terminal of human TULP3. Synthetic peptide located within the following region: EKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTPLVNCHTPHSNVILHG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	tubby like protein 3
Database Link	NP_003315 Entrez Gene 7289 Human UniProt ID O75386
Background	TULP3 is a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.This gene encodes a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.
Synonyms	TUBL3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.