Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1. Synthetic peptide located within the following region: RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	myeloid zinc finger 1
Database Link	NP_003413 Entrez Gene 7593 Human UniProt ID P28698
Background	MZF1 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 SCAN box domain. MZF1 may be one regulator of transcriptional events during hemopoietic development.
Synonyms	MZF-1; MZF1B; ZFP98; ZNF42; ZSCAN6
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.