IRF7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the N terminal of human IRF7. Synthetic peptide located within the following region: ISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	interferon regulatory factor 7
Database Link	NP_004022 Entrez Gene 3665 Human UniProt ID Q92985
Background	IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue.IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established.
Synonyms	IMD39; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Horse: 79%; Mouse: 79%; Zebrafish: 75%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.