IRF7 Rabbit Polyclonal Antibody

CAT#: TA343439

Rabbit Polyclonal Anti-IRF7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human interferon regulatory factor 7 (IRF7), transcript variant a, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant a
    • 100 ug

CNY 4,840.00


Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant d
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the middle region of human IRF7. Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name interferon regulatory factor 7
Background IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes.
Synonyms IMD39; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Rabbit: 92%; Pig: 85%; Bovine: 85%
Reference Data
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...