Foxk1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Foxk1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Foxk1. Synthetic peptide located within the following region: PVPSTAATATATAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	forkhead box K1
Database Link	NP_001032296 Entrez Gene 304298 Rat
Background	The function of this protein remains unknown.
Synonyms	FLJ14977; FOXK1L; IMAGE:5164497; MNF
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Dog: 91%; Rat: 91%; Bovine: 91%; Rabbit: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.