HCFC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HCFC1 antibody: synthetic peptide directed towards the middle region of human HCFC1. Synthetic peptide located within the following region: ARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	209 kDa
Gene Name	host cell factor C1
Database Link	NP_005325 Entrez Gene 3054 Human UniProt ID P51610
Background	HCFC1 is a member of the host cell factor family with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possib
Synonyms	CFF; HCF; HCF-1; HCF1; HFC1; MRX3; PPP1R89; VCAF
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.