c-Myb (MYB) Rabbit Polyclonal Antibody
CNY 5,200.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | MYB proto-oncogene, transcription factor |
Database Link | |
Background | This gene encodes a transcription factor that is a member of the MYB family of transcription factor genes. The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis. Alternative splicing results in multiple transcript variants. |
Synonyms | c-myb; c-myb_CDS; Cmyb; efg |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |