Hdac6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, ChIP, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	126 kDa
Gene Name	histone deacetylase 6
Database Link	NP_034543 Entrez Gene 10013 HumanEntrez Gene 15185 Mouse UniProt ID Q9Z2V5
Background	Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
Synonyms	FLJ16239; HD6; JM21; KIAA0901; OTTHUMP00000197663
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.