PEG3 Rabbit Polyclonal Antibody

CAT#: TA343590

Rabbit Polyclonal Anti-PEG3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Cited in 2 publications.

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of paternally expressed 3 (PEG3), transcript variant 2
    • 100 ug

CNY 4,840.00


Transient overexpression lysate of paternally expressed 3 (PEG3), transcript variant 1
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 181 kDa
Gene Name paternally expressed 3
Background PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.
Synonyms PW1; ZKSCAN22; ZNF904; ZSCAN24
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)

Customer Reviews 
Loading...