ZNF195 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: LTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	zinc finger protein 195
Database Link	NP_009083 Entrez Gene 7748 Human UniProt ID O14628
Background	ZNF195 contains 1 KRAB domain and 10 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Synonyms	HRF1; ZNFP104
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.