HEY2 Rabbit Polyclonal Antibody

CAT#: TA343694

Rabbit Polyclonal Anti-HEY2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 2 (HEY2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 2 (HEY2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 2 (HEY2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 36 kDa
Gene Name hes related family bHLH transcription factor with YRPW motif 2
Background HEY2 is a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. HEY2 forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repres
Synonyms bHLHb32; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 90%; Rabbit: 90%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...