NR2E3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	nuclear receptor subfamily 2 group E member 3
Database Link	NP_055064 Entrez Gene 10002 Human UniProt ID Q9Y5X4
Background	NR2E3 is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. NR2E3 is a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome.This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms	ESCS; PNR; rd7; RNR; RP37
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 86%; Pig: 79%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.