RBM34 Rabbit Polyclonal Antibody
CAT#: TA343823
Rabbit Polyclonal Anti-RBM34 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RBM34 antibody: synthetic peptide directed towards the C terminal of human RBM34. Synthetic peptide located within the following region: SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | RNA binding motif protein 34 |
Database Link | |
Background | RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown. |
Synonyms | KIAA0117 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 76% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |