LYPLA2 Rabbit Polyclonal Antibody
CAT#: TA344253
Rabbit Polyclonal Anti-LYPLA2 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LYPLA2 antibody: synthetic peptide directed towards the N terminal of human LYPLA2. Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | lysophospholipase II |
Database Link | |
Background | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. |
Synonyms | APT-2; APT2; DJ886K2.4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Glycerophospholipid metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |