XRCC2 Rabbit Polyclonal Antibody
CAT#: TA344287
Rabbit Polyclonal Anti-XRCC2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-XRCC2 antibody: synthetic peptide directed towards the middle region of human XRCC2. Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | X-ray repair complementing defective repair in Chinese hamster cells 2 |
Database Link | |
Background | XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | FANCU |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Homologous recombination |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |