LCN12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LCN12 antibody: synthetic peptide directed towards the N terminal of human LCN12. Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	lipocalin 12
Database Link	NP_848631 Entrez Gene 286256 Human UniProt ID Q6JVE5
Background	LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Synonyms	MGC34753; MGC48935
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.